Sale!

weareproudoftakingcareofeverycustomerweserveasiftheyarefamilymembershelpingcustomerslocatethevitalessentialsvitalcatfreezedriedgrainfreeminnowscattreatsvitalessential0.jpg

Vital Essentials Vital Cat Freeze Dried Grain Free Minnows Cat Treats Vital Essentials

Name: We are proud of taking care of every customer we serve as if they are family members. Helping customers locate the Vital Essentials Vital Cat Freeze Dried Grain Free Minnows Cat Treats Vital Essentials
SKU: mode_6684893085887
Price: 5.84 USD
Availability: InStock

Original price was: $ 9,74.Current price is: $ 5,84.

Title

Clear

SKU: mode_6684893085887 Category: Treats Tags: Cat, Dental Care, Endless Aisles, Treats, Vital Essentials

About Vital Essentials

Vital Essentials is a pioneer in the raw pet food industry. Their family-owned company, located in Green Bay, Wisconsin, produces high-quality raw frozen and freeze-dried pet food, snacks, and treats. Vital Essentials uses only USDA inspected animal protein proudly made and packaged in the heartland of the U.S.A.

Vital Essentials Vital Cat Minnows Freeze-Dried Cat Treats are made from pure, raw minnows. We never use added hormones or antibiotics, no added fillers, flavoring or rendered by-products. Single ingredient, high protein cat treats support your cat’s health, naturally. Looking for a little love from your kitty? Then this is the treat for you. Freeze-dried Minnows are a popular pick among our cat families. Cats love the taste because we use a 48-hour slow freeze-drying process that locks in the natural flavor, texture and freshness of the minnow without compromising the nutritional value. A healthy, nutritious and delicious way to feed your cat between meals. Treats with real minnows your cat instinctively craves.

Why We Love It

SINGLE SOURCE PROTEIN: fresh, raw, whole, Minnows, a treat your furry feline already knows. No added hormones or antibiotics, no fillers, flavorings or rendered by-products, ever!
LIMITED INGREDIENT TREAT: the purr-fect treat for your hungry feline! Prepared from pure, raw, Minnows, slow, freeze-drying process, no muss, no fuss!
100% USA SOURCED, MADE AND PACKAGED: freeze-dried, ensuring a fresh, safe, raw, pet treat that is light-weight and delicious for your four legged family member.

About Vital Essentials

Ingredients

Minnows

Title	0.5-oz

Prompt Shipping and Professional Packing

Due to our long-term partnership with UPS, FedEx, DHL and a variety of other top global carriers we can offer various shipping options. Our warehouse staff will package all goods to our exacting requirements. The goods you send us are checked thoroughly and securely secured prior to shipment. Everyday we deliver thousands of packages to clients from all over the world. Our dedication to becoming the biggest online retailer around the globe is evident by this. We have distribution centers as well as warehouses in Europe and the USA.

It is important to note that orders with multiple items are given a processing time according to the specific item.

Before shipping We will inspect thoroughly the items you have ordered. The majority of orders are shipped within 48 hours. The estimated delivery time is between 3-7 days.

Returns

Due to multiple entities, including the factory and the warehouse, we are unable to fully manage stock. Stock levels can fluctuate at any time. It is possible that inventory could run out once your order has been processed.

Our policy is valid for 30 days. If it's been more 30 days since you made your purchase and we're unable to offer you a full exchange or refund.

To be eligible for return the item must not be opened and in the same condition as when you received it. It must also be returned in its original packaging.

Vital Essentials Vital Cat Freeze Dried Grain Free Minnows Cat Treats Vital Essentials

Related products

Login